Protein Info for BPHYT_RS09210 in Burkholderia phytofirmans PsJN

Annotation: DNA repair protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02772: Ku protein" amino acids 3 to 265 (263 residues), 331 bits, see alignment E=2.6e-103 PF02735: Ku" amino acids 11 to 195 (185 residues), 162.4 bits, see alignment E=6.2e-52

Best Hits

Swiss-Prot: 51% identical to KU_PSESM: Non-homologous end joining protein Ku (ku) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 100% identity to bpy:Bphyt_1857)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3V4 at UniProt or InterPro

Protein Sequence (333 amino acids)

>BPHYT_RS09210 DNA repair protein (Burkholderia phytofirmans PsJN)
MPHMIWKGAISFGLVHVPVQLYPATQSEKVGFNLLDKRSIDPIGYKQINKRTGKDVTRDN
IVRGFEYEKDKYVVLSDDEIRSANPESTQTVDILAFVDAPDISFLYLDTPYFLTPDRKGE
KVYALLREAMKASGKIGVASVVLHNKQHLAALIPVGPVLALNTLRWAAEVRDFDEFKLPA
DGVKAAGVSARELDMAKKLIDDMSDKWDPSQYHDTFRDDIMALVDRKIRAGKTEEITEVE
APHESRQSADILDLSDLLKRSLGRGKGKPAAGGRKRTADDDSDEADADAETETPARKKPR
TTRTASKTTTRGGGRATAKTASAPAARKRRAAA