Protein Info for BPHYT_RS09170 in Burkholderia phytofirmans PsJN

Annotation: ribosomal protein S12 methylthiotransferase RimO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 14 to 459 (446 residues), 559.5 bits, see alignment E=5.8e-172 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 14 to 459 (446 residues), 330.3 bits, see alignment E=1.7e-102 PF00919: UPF0004" amino acids 14 to 93 (80 residues), 68.2 bits, see alignment E=7.8e-23 PF04055: Radical_SAM" amino acids 154 to 340 (187 residues), 83.2 bits, see alignment E=3.8e-27 PF18693: TRAM_2" amino acids 396 to 461 (66 residues), 78.7 bits, see alignment E=4.4e-26

Best Hits

Swiss-Prot: 100% identical to RIMO_PARPJ: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 100% identity to bpy:Bphyt_1848)

MetaCyc: 66% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3U5 at UniProt or InterPro

Protein Sequence (461 amino acids)

>BPHYT_RS09170 ribosomal protein S12 methylthiotransferase RimO (Burkholderia phytofirmans PsJN)
MSATPPIVPTATPKVGFVSLGCPKALVDSEQIITQLRAEGYEISGTYDGADLVVVNTCGF
IDEAVQESLDAIGEALNENGKVIVTGCLGAKKSASGSGLIEEVHPKVLAVTGPHALGEVM
QHVHTHLPKPHDPFVDLVPAAGVKLTPRHYAYLKISEGCNHRCTFCIIPSMRGDLVSRPV
ADVMLEAENLFKSGVKELLVISQDTSAYGVDVKYRTGFWNGKPIKTRMTDLVGALGELAA
QYGAWVRLHYVYPYPSVDEVIPMMAEGPYKGHVLPYLDVPFQHAHPEVLKRMKRPANAEK
VMERVKKWREMCPDLTIRSTFIAGFPGETEEQFQTLLDFIREAELDRVGCFAYSPVEGAT
ANELDGALPDEVREERRARFMEVAEEVSAKRIAKKVGKTLKVLVDEINADGGIGRTAADA
PEIDGVVYIAPAAKASKRYKVGDFVSVKITGADGHDLWGEV