Protein Info for BPHYT_RS09165 in Burkholderia phytofirmans PsJN

Annotation: tRNA-dihydrouridine synthase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF01207: Dus" amino acids 6 to 312 (307 residues), 216.2 bits, see alignment E=3.1e-68

Best Hits

Swiss-Prot: 83% identical to DUSC_CUPNH: tRNA-dihydrouridine(16) synthase (dusC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K05541, tRNA-dihydrouridine synthase C [EC: 1.-.-.-] (inferred from 100% identity to bpy:Bphyt_1847)

Predicted SEED Role

"tRNA-dihydrouridine synthase C (EC 1.-.-.-)" in subsystem Murein hydrolase regulation and cell death (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3U4 at UniProt or InterPro

Protein Sequence (340 amino acids)

>BPHYT_RS09165 tRNA-dihydrouridine synthase C (Burkholderia phytofirmans PsJN)
MSRLYLAPMEGLADYVLRDVLTGIGGFDGCVSEFIRVTGSVLPTRVYEREAPEVLDAGHT
PNGTPMVVQLLGSDPEWMALNAAHAATLSPHGVDLNFGCPAKVVNQHGGGAMLLADPEQL
NRIVSAVRAAVPADILVTAKMRLGVSDTSLAIDCATALAEGGAASLVVHARTRDHGYRPP
AHWEWIARIDAAVDVPVIANGEVWTVTDWERCRAVSGCDDVMIGRGAVSDPFLALRIRGL
MDRSPSNEDWRDVLGHMAGYLRKLQARVASRHEHGRVKKWLSYLQRTWPQAAELHAAIRR
VQDSQEIQDVIERALGVGQSMATHRSGRLSQRDPADLAVV