Protein Info for BPHYT_RS09145 in Burkholderia phytofirmans PsJN

Annotation: poly-beta-hydroxybutyrate polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 330 to 350 (21 residues), see Phobius details TIGR01838: poly(R)-hydroxyalkanoic acid synthase, class I" amino acids 81 to 607 (527 residues), 714.6 bits, see alignment E=3.3e-219 PF07167: PhaC_N" amino acids 114 to 280 (167 residues), 217.2 bits, see alignment E=1.3e-68 PF00561: Abhydrolase_1" amino acids 255 to 527 (273 residues), 95.9 bits, see alignment E=3.3e-31

Best Hits

Swiss-Prot: 65% identical to PHAC_CUPNH: Poly(3-hydroxyalkanoate) polymerase subunit PhaC (phaC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 100% identity to bpy:Bphyt_1843)

MetaCyc: 65% identical to poly-beta-hydroxybutyrate polymerase subunit (Cupriavidus necator)
RXN1-42 [EC: 2.3.1.304]

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.304

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3U0 at UniProt or InterPro

Protein Sequence (609 amino acids)

>BPHYT_RS09145 poly-beta-hydroxybutyrate polymerase (Burkholderia phytofirmans PsJN)
MQQFVDAWMNAWRSLGTSPGGSGMPFAMPQMPMQMPQMGLPQGFPQIPSFPGMPDFSKLA
AGSMPGMPSFAGLNIPTAAIPSERLQKLQADYSREAMELIQQATTSATQAPQLKDRRFSS
DAWSSAPAYAFTAAWYLLNARYLQEMVDALDTEPKVRERIRFAVQQWTAAASPSNFFALN
PEAQKTLLDSKGESLRQGVMNLLGDLQRGKISQTDESGFVVGENLANTEGSVVFENDLMQ
LIQYKPRTATVRERPLLIVPPCINKFYILDLQPENSLVAHGLDSGHQVFLISWRNADQSI
AHKTWDDYIGEGVLTAIDTVSKISGREQINTLGFCVGGTMLAAALAVAAARGEHPAASMT
LLTAMLDFSDTGVLDVFVDEQHVQMREQTIGGKNGTPPGLMRGIEFANTFSFLRPNDLVW
NYVVDNYLKGRTPVPFDLLYWNSDSTSLPGPMYVWYLRNTYLENRLREPGALTTCGQPID
LSKIDVPTFIYGSREDHIVPWQTAYASVPLLSGPLKFVLGASGHIAGVINPPAKKKRNFW
MLEGDVKTLPENPEEWLDQATEVPGSWWPEWTTWLDQYGGKKVKPRATAGSADYPVIEPA
PGRYVRQRE