Protein Info for BPHYT_RS09100 in Burkholderia phytofirmans PsJN

Annotation: stationary phase survival protein SurE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00087: 5'/3'-nucleotidase SurE" amino acids 1 to 233 (233 residues), 221.9 bits, see alignment E=4.5e-70 PF01975: SurE" amino acids 3 to 182 (180 residues), 205.6 bits, see alignment E=3e-65

Best Hits

Swiss-Prot: 98% identical to SURE_PARXL: 5'-nucleotidase SurE (surE) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 100% identity to bpy:Bphyt_1834)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3T1 at UniProt or InterPro

Protein Sequence (252 amino acids)

>BPHYT_RS09100 stationary phase survival protein SurE (Burkholderia phytofirmans PsJN)
MRILLSNDDGYLAPGLAALYEALKPIADVTVMAPEQNCSGASNSLTLSRPLSVLRSANGF
YYVNGTPTDSVHIALTGMLDHTPDLVVSGINNGQNMGEDTLYSGTVAAATEGIMFGVPAI
AFSLVDKDWVHLDDAVRVAAEIVAHYLEQPLPGHPLLNVNIPNLPYEQLGDWQITRLGKR
HPSQPVIRQTNPRGEPIYWIGPAGSARDASEGTDFHAVANGHVSITPLQLDLTHTQMLPA
ARDWARAGGGAS