Protein Info for BPHYT_RS08860 in Burkholderia phytofirmans PsJN

Annotation: primosomal replication protein N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 TIGR04418: primosomal replication protein PriB" amino acids 2 to 95 (94 residues), 109.5 bits, see alignment E=3.4e-36

Best Hits

Swiss-Prot: 36% identical to PRIB_NITEU: Primosomal replication protein N (priB) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K02686, primosomal replication protein N (inferred from 100% identity to bxe:Bxe_A2455)

Predicted SEED Role

"Primosomal replication protein N" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3N4 at UniProt or InterPro

Protein Sequence (99 amino acids)

>BPHYT_RS08860 primosomal replication protein N (Burkholderia phytofirmans PsJN)
MNRLQLTASVVEREPVRYTPAGVPIAGCTLHHRTEVVEAGIARQVELTMQAVAAGEASGK
LESCQMGVETLFTGFLAKKHRNARTLVFHITALQDIGKD