Protein Info for BPHYT_RS08805 in Burkholderia phytofirmans PsJN

Annotation: sulfate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 243 (241 residues), 391.2 bits, see alignment E=8.1e-122 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 131.6 bits, see alignment E=1e-41 PF17850: CysA_C_terminal" amino acids 241 to 282 (42 residues), 32.6 bits, see alignment 2.9e-11 PF08402: TOBE_2" amino acids 275 to 342 (68 residues), 21.7 bits, see alignment E=5.4e-08 PF12857: TOBE_3" amino acids 289 to 344 (56 residues), 54.8 bits, see alignment E=2e-18

Best Hits

Swiss-Prot: 82% identical to CYSA_BURMA: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Burkholderia mallei (strain ATCC 23344)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 100% identity to bxe:Bxe_A2467)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3M3 at UniProt or InterPro

Protein Sequence (352 amino acids)

>BPHYT_RS08805 sulfate ABC transporter ATP-binding protein (Burkholderia phytofirmans PsJN)
MGITVRNLQKRFGDFVALDNVSLDFPPGELVALLGPSGCGKTTLLRVIAGLEYADGGQVV
LQGQDVATVGAREREVGFVFQHYALFRHMTVFENVAFGLRVKPRKERPSEAVIREKVHEL
LKLVQLDWLAQRYPSELSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRSWLR
RLHDDLHISTIFVTHDQEEALEVADRIVVLNRGHVEQVGSPQDVYDHPQTSFVYEFLGAA
NRLHGNVDASGFVVDGAALPVSIKADFSGPAFAYVRPHDLQLYPQASGHREGIVVDVRRV
VTLGGSVRVELAGREGNLLEAELDREAWRDLQLSIGDGVTAVPRALRVFPAQ