Protein Info for BPHYT_RS08785 in Burkholderia phytofirmans PsJN

Annotation: LexA repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR00498: repressor LexA" amino acids 1 to 212 (212 residues), 215.3 bits, see alignment E=3.3e-68 PF01726: LexA_DNA_bind" amino acids 1 to 65 (65 residues), 96.1 bits, see alignment E=8.2e-32 PF00717: Peptidase_S24" amino acids 92 to 207 (116 residues), 106.5 bits, see alignment E=6.9e-35

Best Hits

Swiss-Prot: 100% identical to LEXA_PARPJ: LexA repressor (lexA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 99% identity to bxe:Bxe_A2471)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.88

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3L9 at UniProt or InterPro

Protein Sequence (216 amino acids)

>BPHYT_RS08785 LexA repressor (Burkholderia phytofirmans PsJN)
MTKLTARQQQVFDLIRRAIERTGFPPTRAEIAAELGFSSANSAEEHLRALARKGVIELAA
GASRGIRLLAGPEDSPHQFTLPHASIMQLSLPLIGRVAAGSPILAQEHISQHYACDPALF
SSKPDYLLKVRGLSMRDAGIFDGDLLAVQKRSEAKDGQIIIARLGDDVTVKRLKRRPNGL
ELIAENPDYENIFVETGSAEFALEGIAVGLIRPGEF