Protein Info for BPHYT_RS08710 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 PF14559: TPR_19" amino acids 22 to 78 (57 residues), 26.5 bits, see alignment 4.5e-09 amino acids 90 to 149 (60 residues), 28.2 bits, see alignment E=1.3e-09 PF13181: TPR_8" amino acids 80 to 110 (31 residues), 16.1 bits, see alignment (E = 6.8e-06) amino acids 114 to 144 (31 residues), 22.5 bits, see alignment (E = 6.1e-08) PF13432: TPR_16" amino acids 84 to 146 (63 residues), 35.3 bits, see alignment E=8.9e-12 PF13176: TPR_7" amino acids 115 to 144 (30 residues), 17 bits, see alignment (E = 3.3e-06) PF00515: TPR_1" amino acids 115 to 144 (30 residues), 32 bits, see alignment (E = 4.8e-11) PF07719: TPR_2" amino acids 115 to 144 (30 residues), 30.4 bits, see alignment (E = 1.7e-10) PF00685: Sulfotransfer_1" amino acids 254 to 461 (208 residues), 22.7 bits, see alignment E=3.8e-08 PF13469: Sulfotransfer_3" amino acids 254 to 460 (207 residues), 159.1 bits, see alignment E=1.3e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1757)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3K4 at UniProt or InterPro

Protein Sequence (530 amino acids)

>BPHYT_RS08710 hypothetical protein (Burkholderia phytofirmans PsJN)
MKQDPQPAVAREWRAEGDACAARGELDAALQRYESARALDPTDALVQQRLAATLAALNRF
PEAVVRYHEAIALDPRDKDSHHGLGWTLEQMHRLEQAVDAYREATRVNPQADGSHNNMGN
CLQALGRFDEAHEAYRRAIEAAPQVPLYYRNFVQSKRLAADDPVFLAMERLVVDAASLTP
ANQAELHFAYGQALSDVGCNDASFDHFLKGNALHRAGVRYNEAETLGLFAHLPELMTAEL
LASKRGLGDASQAPIFIVGMPRSGSTLIEQILASHPQVFGAGERTEFGEALVNCIRRDLD
DPLRIDIEALEEVGAAPLRALGVDYLRRMRNALPELQSRAQNDQRNPAANYTHFTDKYPF
NFINLGLIHLALPNARFIHSSRAPLPTCLSIFSRIFHDVPFSYDLGELGRYYRAYDALMA
HWQRVLPEGVMIEVKYEELVDDFEANVHRLLAHCGLEWDERCLSFYQTARQVNTASSAQV
RRPLYKTSLQRWQPPRALLQPLLDGLGSELAAAHRHETGEVEASGTEHRS