Protein Info for BPHYT_RS08645 in Burkholderia phytofirmans PsJN

Annotation: sulfonate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 186 to 216 (31 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 265 (168 residues), 99.5 bits, see alignment E=1e-32

Best Hits

Swiss-Prot: 66% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to bpy:Bphyt_1745)

MetaCyc: 66% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3J2 at UniProt or InterPro

Protein Sequence (280 amino acids)

>BPHYT_RS08645 sulfonate ABC transporter (Burkholderia phytofirmans PsJN)
MAESTVSAARHEGAEAGSGLNTLRRVGAHLAPWLAPLAILLAWEFAARSGVLSTRVLPEP
LAVVKAAWSLIQSGEMWTDVKVSTWRAVSGFAIGGGIGLVLGLATGLFKPAEIALDSTVQ
MVRNIPALAMIPLVILWFGIEEQAKVFLVALGVFFPIYVNTFHGIRSVDANLIEMARSYG
VKGFALYRHVILPGALPSILVGVRFAFGLMWVTLIVAETISAQSGIGYMTMNAREFLQTD
VVVVGILLYAALGKLADVLAKSLERVSLRWHPAYQRGAKS