Protein Info for BPHYT_RS08595 in Burkholderia phytofirmans PsJN

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 6 to 96 (91 residues), 107.3 bits, see alignment E=2.4e-35

Best Hits

Swiss-Prot: 62% identical to QACE_KLEAE: Quaternary ammonium compound-resistance protein QacE (qacE) from Klebsiella aerogenes

KEGG orthology group: K03297, small multidrug resistance protein, SMR family (inferred from 100% identity to bpy:Bphyt_1735)

MetaCyc: 50% identical to DLP12 prophage; multidrug/betaine/choline efflux transporter EmrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-344; TRANS-RXN0-493; TRANS-RXN0-532; TRANS-RXN0-533; TRANS-RXN0-628

Predicted SEED Role

"Ethidium bromide-methyl viologen resistance protein EmrE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3I2 at UniProt or InterPro

Protein Sequence (112 amino acids)

>BPHYT_RS08595 multidrug transporter (Burkholderia phytofirmans PsJN)
MRLPPYALLGIAIVAEVIATSAMRASEGFSRLLPSAVVVLGYGVAFYCLSLTLKSIPVGI
VYAVWSGAGIVLITLVAVLLYRQVPDVPAVIGLGLIIAGVAVLNMFSKMQAH