Protein Info for BPHYT_RS08315 in Burkholderia phytofirmans PsJN

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 367 to 394 (28 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details PF00654: Voltage_CLC" amino acids 85 to 414 (330 residues), 247.1 bits, see alignment E=1.5e-77

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1681)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3D0 at UniProt or InterPro

Protein Sequence (443 amino acids)

>BPHYT_RS08315 chloride channel protein (Burkholderia phytofirmans PsJN)
MSVKSTTSEPVRREHSPFAVVAAVTLLTGLGAGLGGMLLALLLHGIQHLAYGYSVTHVIS
AESFLQGVSAAAPERRLLVLTICGLIAGFGWWALYRFGRPLVSIRQAVKSDDPQMPVMST
TIHAVLQIVTVALGSPLGREVAPREIGSALAGWLSRRAGLSAAQSRIMVACGAGAGLAAV
YNVPLGGAVFVLEVLLGTFGWPALVPAIVTSSVAALVAQLGLGNEHQYLVASMTLSPALV
VWSVVCGPIFGVAAWSFAELMKRSRAAAPKNWRLPVLSLLNFATIGVFAMHFPQLLGNGK
GPAGLAFDGGLTISLAAMLLVLKVVITASSLRAGAEGGLLTPGLANGALLAIVLGGLWSL
AWPGASLGAFAVVGATAFLAASMQMPITAVVLMFEFTRVSQDFLIPVLFAMGGALLGFRA
CAKWAPALQSSVGFGWSGASKAR