Protein Info for BPHYT_RS08300 in Burkholderia phytofirmans PsJN

Annotation: sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 222 (204 residues), 101.3 bits, see alignment E=5.4e-33 amino acids 218 to 387 (170 residues), 53.3 bits, see alignment E=2.2e-18 PF00083: Sugar_tr" amino acids 49 to 195 (147 residues), 89.5 bits, see alignment E=2.4e-29 amino acids 233 to 385 (153 residues), 48.6 bits, see alignment E=6.1e-17

Best Hits

KEGG orthology group: K08178, MFS transporter, SHS family, lactate transporter (inferred from 100% identity to bpy:Bphyt_1678)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3C7 at UniProt or InterPro

Protein Sequence (406 amino acids)

>BPHYT_RS08300 sugar transporter (Burkholderia phytofirmans PsJN)
MSWTREQRNVTIAAYLGWTLDAFDFFLMVFVLKDIAAEFNTKIPEVAFGIMLTLVMRPLG
ALIFGWLADKYGRRPTLMVNIACFSLLELLSGFSPNLATLLVLRALFGIAMGGEWGVGGA
LTMETVPPKSRGIVSGLLQAGYPSGYLLASVVFGVFYQYIGWRGMFFVGVLPALLVLYVR
AHVPESPAFKTLEKKARPGLVATLRQNVKLSLYAIVLMTAFNFFSHGSQDLYPTFLRVQH
QFDAHTVSWITITLNVGAICGGLFFGALSEKIGRKRAIFIAALIALPVLPLWAFSTTPVL
LAVGAFLMQISVQGAWGVIPVHLNEISPDEIRATFPGLVYQLGNLIASVNGPLQASAAEA
HGNNYALIMAIVIGIVAVVIAALIPFSRERRGIDMTQSAKQVAAQL