Protein Info for BPHYT_RS08090 in Burkholderia phytofirmans PsJN

Annotation: hemolysin D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details TIGR00998: efflux pump membrane protein" amino acids 34 to 359 (326 residues), 396.4 bits, see alignment E=4.6e-123 PF16576: HlyD_D23" amino acids 74 to 303 (230 residues), 48.5 bits, see alignment E=1.8e-16 PF13533: Biotin_lipoyl_2" amino acids 75 to 123 (49 residues), 40.2 bits, see alignment 5.7e-14 PF00529: CusB_dom_1" amino acids 184 to 359 (176 residues), 45.4 bits, see alignment E=1.6e-15 PF13437: HlyD_3" amino acids 234 to 343 (110 residues), 51.6 bits, see alignment E=3.3e-17

Best Hits

Swiss-Prot: 54% identical to EMRA_ECOLI: Multidrug export protein EmrA (emrA) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to bpy:Bphyt_1636)

MetaCyc: 54% identical to multidrug efflux pump membrane fusion protein EmrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T385 at UniProt or InterPro

Protein Sequence (424 amino acids)

>BPHYT_RS08090 hemolysin D (Burkholderia phytofirmans PsJN)
MSTTQQPAATTQPTQSAPQPTQPPAQPPANNGKRKRMMTLLVIVILIAAIAYGLYYFLVA
RFHEDTDDAYVNGNVVQITPQVTGTVVAVNADDTQTVKVGDPLVVLDPADARVALEQAEA
NLAQTVRQVRGLFADDNQYQAQVAQRQADLSRAQDDLKRRLTVAQTGAVSQEEISHARDA
VKSAQAAVDAAQQQLNSNRALTANTTIANHPNVQAAAAKVRDAYLNNARNNLPAPVTGYV
AKRSVQVGQRVSPGTPLMAIVPLGGVWVDANFKEVQLKHMRIGQPVELTADVYGSSVVYH
GKVVGFSAGTGSAFSLLPAQNATGNWIKVVQRLPVRIALDPKELEQHPLRIGLSMQADVS
IKDDNGGQLGQAPNTVYQTAVFEKYGDEADAEIARIISQNAGPNGGSQKSSQADGAKPVA
AKVM