Protein Info for BPHYT_RS07915 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 182 to 201 (20 residues), see Phobius details PF05227: CHASE3" amino acids 35 to 165 (131 residues), 52.1 bits, see alignment E=1.1e-17 PF00512: HisKA" amino acids 285 to 368 (84 residues), 28.3 bits, see alignment E=2.3e-10 PF02518: HATPase_c" amino acids 412 to 526 (115 residues), 86.8 bits, see alignment E=2.1e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1602)

Predicted SEED Role

"FIG00457619: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T351 at UniProt or InterPro

Protein Sequence (582 amino acids)

>BPHYT_RS07915 histidine kinase (Burkholderia phytofirmans PsJN)
MRLTTKGLLLIAIPALFELALLSGLVKAQSDAAQAERWAVHSQDVLRQTTAILDPVLGES
VALRGAVLANDARFSTPVSVWVDVDRRIDQLAELVADNPAQVERVVQVRQSVQAYRQWSD
RIQDMLHSGRRRDVLARFRELAPADVLDRFRQQVAAFQAEERRLDTLRSNAADAARERQQ
TLVLAAVLGSLLFVALAVWLFTRGVRGRLAVLADNAGRLAGNEPLAPIGPGHDEIARLDL
TLHETSRRLLEAERIQARFRADLARRTGELARINENLRQQTQENEMFIYSVSHDLRAPLV
NLQGFSKELIRSCDELRAAVRESSLAAQTRQRIERVVDEDIGEALHYLQTAVLRASHIID
ALLHLSRVGRVEYRQQKVEVRDIVPRVIDAMQGSIRARRALVSVDELPAVWGDPTALEQV
FANLIGNAVNYLDPSREGRIEIGTTPAPPGVHSLRIFYVRDNGLGIPAVALPRLFNAFQR
LHGNVAAGEGIGLALVRRVVERHGGRVWAESKEGVGTTFYLSLPEAGARIAQQAAGTSAR
LAVTSVQAVRDAGTGLEDRDRRSGSDGDAAQAADTRPGVSAP