Protein Info for BPHYT_RS07690 in Burkholderia phytofirmans PsJN

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12833: HTH_18" amino acids 242 to 319 (78 residues), 80.8 bits, see alignment E=7.4e-27 PF00165: HTH_AraC" amino acids 283 to 316 (34 residues), 30.1 bits, see alignment 4.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1557)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T309 at UniProt or InterPro

Protein Sequence (349 amino acids)

>BPHYT_RS07690 AraC family transcriptional regulator (Burkholderia phytofirmans PsJN)
MARTSNPARTTQVAIVALPPVSMSGVGPIVDALNLANEIDGRALYRVQVCSWDGRAVPLA
GGAHWPADAAFGDAIACDWLIIVSERFQQFADYRLFLASLSRVGQRTPLVTGIHHGVWWL
AMAGQLSGYRVSVNWETYQQFSEQFERSIVTQQIFEIDRDRATCAGGQATVDFMLAMIGR
EHGPELADRIADTLGVGVLRAGEERQRIPFVTAPGERHPRLNDALLLMEANIEDPLTTDE
IAGLIGVSRRQLERLFRQYLGSMPSKYYLGLRLSKARTQLQRTSKSVVQISLACGFSSAA
HFSNAYRERFGVTPREDRRNWIDKQTGASGAAASEPRPGALIERPDQAD