Protein Info for BPHYT_RS07675 in Burkholderia phytofirmans PsJN

Updated annotation (from data): ABC transporter for L-Arginine, permease component 2
Rationale: Very important for utilization of L-arginine
Original annotation: histidine/lysine/arginine/ornithine ABC transporter permease HisQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 191 to 216 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 8 to 115 (108 residues), 63.7 bits, see alignment E=9.6e-22 PF00528: BPD_transp_1" amino acids 31 to 220 (190 residues), 82.2 bits, see alignment E=2e-27

Best Hits

Swiss-Prot: 64% identical to HISQ_SALTI: Histidine transport system permease protein HisQ (hisQ) from Salmonella typhi

KEGG orthology group: K10016, histidine transport system permease protein (inferred from 100% identity to bpy:Bphyt_1554)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T306 at UniProt or InterPro

Protein Sequence (229 amino acids)

>BPHYT_RS07675 ABC transporter for L-Arginine, permease component 2 (Burkholderia phytofirmans PsJN)
MFLYGFGPVLLAGTIQTIELSVLSLAAAVLLGLAGAAAKLSFNRPLRAIATGYTTLIRSV
PDLVLMLLLFYSIQIAVNNLTDALNLPQFDIDPFVAGVLTLGFIYGAYFTETFRGAFLAV
PRGQLEAGSAYGMSGARVFTRILFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTFNMFFFILVAALIYLAITTASNLVLIWLEKRYSIGVRHAEL