Protein Info for BPHYT_RS07660 in Burkholderia phytofirmans PsJN

Annotation: sulfonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 57 to 325 (269 residues), 202.8 bits, see alignment E=3.4e-64 PF13379: NMT1_2" amino acids 74 to 208 (135 residues), 25.1 bits, see alignment E=3e-09 PF12974: Phosphonate-bd" amino acids 83 to 198 (116 residues), 38.8 bits, see alignment E=1.5e-13 PF09084: NMT1" amino acids 85 to 260 (176 residues), 58.7 bits, see alignment E=1.7e-19

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_1551)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T303 at UniProt or InterPro

Protein Sequence (328 amino acids)

>BPHYT_RS07660 sulfonate ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MTTSRFSFAIRSFVKRALSTAPRVAALAASAVLCAAPSYGADVPVLKVGDQSLQTRGILE
ASGQLKDLPYKIEWFNFPAAQPLGEALNAGAVDVGGLGDAPLVFALAAGARVRAVAATRS
NPLDLAIVVGAQSPLHDAASLKGKRIATTRGSIGHYLALAALKKANVPLTDVTFVFLAPA
DAKAALASGSVDAWSVWDPYTALGEARDHDRIIANGVGLSEGLSYQVATERAITDKRAQL
ADFLRRVAIGQRWALSHPDEVATMQSRVTGLPTDVLKTVYQRGQVHPVAIDDSVVAAQQR
TADTYEAANVIRAHLDVRTSFDRSFPLP