Protein Info for BPHYT_RS07375 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details PF16963: PelD_GGDEF" amino acids 342 to 465 (124 residues), 170 bits, see alignment E=9.6e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1494)

Predicted SEED Role

"Extracellular Matrix protein PelD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2U7 at UniProt or InterPro

Protein Sequence (470 amino acids)

>BPHYT_RS07375 membrane protein (Burkholderia phytofirmans PsJN)
MNTAAVENNPGASKPRHAHPFGNLGRVRRLLAPAVARPFAIVETVVLVLVVLAVAHWLHP
EDPLLLHNGFPWLWLASLLVALRYGSLLGLLSGALMLGAWALFYPHGGPFPTLYFAGGLI
QTILAGHFGDTWGSRAERASSLNDYLNDRLVALTNSHYLMRLSHERLEKDLLSRPTTLRD
SITELRRLSVATDTALAAPATGKENDPLGGASGLLEFVAQACQIEVAALYPVHHGKLGTQ
AIAQIGDPFEFAAHDELVTHALNTLSVAHLKNEDTVVPVSQYLVCAPLVSADGELRALLV
VKRMPFLSLNFDNLQLLLVLLGYYADGVEHSAFVQRILDRVPNCPYEFALDLSRLTRLQQ
KAGVASSLVALAFPRDEEGDSLFEHVMRRRRSLDVMWPVQTAKQSVLVNLMPATDTTGID
GYLARIEASLTAQFNTDLERARVGVHTLHLEGDEPGAALMRLLKRSGLDV