Protein Info for BPHYT_RS07025 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 97 to 126 (30 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 348 to 365 (18 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details PF05977: MFS_3" amino acids 18 to 400 (383 residues), 119.3 bits, see alignment E=1.7e-38 PF07690: MFS_1" amino acids 26 to 360 (335 residues), 104.2 bits, see alignment E=7.2e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1420)

Predicted SEED Role

"MFS general substrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2M8 at UniProt or InterPro

Protein Sequence (420 amino acids)

>BPHYT_RS07025 MFS transporter (Burkholderia phytofirmans PsJN)
MPPAPAEPPGTSSVSLPKHPAFQRFWCTRILSSLSFQMLAVAMGWHIYALTHSAFALGLV
GLAQFLPMFVLTLVVGHVADRYDRRRIAAICQSLESVAALLFAVGTFSGWISAPVIYVLA
ACVGAARAFESPAVASLLSGVVPRGQLPKATAWATSANQTAQIAGPALGGLLYGIGPGAA
YLACTLSFAAAAAAVSGISLQTKPANRAPVTLESVFSGIAFIRREPVILGALSLDLFAVL
FGGATALLPIFARDILHTGPLGLGLLRSGTAIGALAGTVWLAHFPLRNRPGAAMFGGVVA
FGAATVVFGLSHQFLASLIALMVLGASDTISVVVRLSLVQLRTPDEMLGRVSAVNSLFIG
TSNQLGEFESGLTAGWWGAQPAVLVGGVATIAVALLWMRFFPELRRTRSLEREEELAPSP