Protein Info for BPHYT_RS07020 in Burkholderia phytofirmans PsJN

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 239 to 256 (18 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 340 to 364 (25 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 16 to 355 (340 residues), 113 bits, see alignment E=7.8e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1419)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2M3 at UniProt or InterPro

Protein Sequence (377 amino acids)

>BPHYT_RS07020 acyltransferase (Burkholderia phytofirmans PsJN)
METHSIRDASSLRYVTGLDGLRAISMMLVVLFHYTSYFSSPLSQLGGAWSGIVRIASTGW
IGVDVFFVISGFLITTTLLKRPVNSVASYAKFIQRRAIRLLPAYVASLLIFTLIALLIDP
HSKVLKNEYLLWTFTTSLQSLFGDRVALADQHFTMAHFWTLAVEWHFYIVFPILVARFHS
YFRPAVVLLLVAMSFRVVCHFAGISDNGIYTFTLCRIDSIAVGCLLALVPSHLRSRQSAA
AGVLGVAMFMAIWIALACSDVPFKTLAWLQTFGYTLLAVSVALMIYRVIHSSARSPVVRA
LECKPLTAIGRASYSLYIWHVPFYPSIALLAQRNFADIRLAYLVAVLAGVVMTAALGSLS
YLLVESRFTRARPAVLA