Protein Info for BPHYT_RS06990 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 4 to 163 (160 residues), 199.5 bits, see alignment E=2.4e-63 PF03350: UPF0114" amino acids 8 to 124 (117 residues), 121.1 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 60% identical to Y1258_PASMU: UPF0114 protein PM1258 (PM1258) from Pasteurella multocida (strain Pm70)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1414)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2L8 at UniProt or InterPro

Protein Sequence (189 amino acids)

>BPHYT_RS06990 membrane protein (Burkholderia phytofirmans PsJN)
MRPIPSIIFMSRWLQLPLYLGLIVAQAVYVVLFLKEVWHLVTASMTLDETNIMLVVLGLI
DVVMISNLLIMVIIGGYETFVSRLGVEGHPDEPEWLDHVNAGVLKVKLSMALISISSIHL
LKTFISPDQNSTHTIMWQVIIHVAFLVSALVMAAVDRLTTHTHPKHFEEPAVLHAVGSVK
GSTPLKAHD