Protein Info for BPHYT_RS06975 in Burkholderia phytofirmans PsJN

Annotation: glutamate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR00067: glutamate racemase" amino acids 23 to 268 (246 residues), 202.8 bits, see alignment E=3e-64 PF01177: Asp_Glu_race" amino acids 35 to 230 (196 residues), 81.1 bits, see alignment E=5.4e-27

Best Hits

Swiss-Prot: 61% identical to MURI_RALPJ: Glutamate racemase (murI) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01776, glutamate racemase [EC: 5.1.1.3] (inferred from 100% identity to bpy:Bphyt_1411)

Predicted SEED Role

"Glutamate racemase (EC 5.1.1.3)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Peptidoglycan Biosynthesis (EC 5.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2L5 at UniProt or InterPro

Protein Sequence (295 amino acids)

>BPHYT_RS06975 glutamate racemase (Burkholderia phytofirmans PsJN)
MPAESSTANTGMFTSGAGTRTPVGIFDSGLGGLSVLRAVRAQLPDEAILYVADSLYAPYG
ERDDDFIADRTLAIGEWLVKQGAKALVVACNTATAQSIALVREKLPIPLVGVEPGVKPAA
LQSKTRVAGVLATQVTLRSARFQALLERYAADCRFLCQPGHGLVQAVERCDVGSAELRAL
LRGYLQPMLDAGADTLVLGCTHYPFLDAAIRDIVGDRLMLIDTSIAIARQLERVLDQHGL
RAVPPSAATVSPRFFSTGDGTHQQQLAATLLHIDATVETVSIPSRRTAAPNSQAA