Protein Info for BPHYT_RS06810 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 12 to 43 (32 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 150 to 176 (27 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 241 to 269 (29 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 306 to 333 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 343 (330 residues), 127.9 bits, see alignment E=2.6e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1381)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2I5 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BPHYT_RS06810 membrane protein (Burkholderia phytofirmans PsJN)
MVKSDQLIERLAAVFALIILVGGSLLVLAPFTTALLWGAILSYSSWGLYRRLTAALGGRR
KGAATLIVLIILIVVLGPFVYAGFAFGAHVHEIVALVQRLFEAGLPDLPPWVARIPLVGS
NIEAFWERLTSSNSELIAQLRTLAAPAGKWILAAAIAVTHGLGLLALSIVLAFFFYTGGE
GAAAWLNAGMRRIAGERADYLLALAGSTVKGVVYGILGTALVQGILAGFGCWIAGVPAPA
LLGLATFFLSVIPGGPVVVWLPAAIWLYHGGATGWAIFLVVWGVLAVGMSDNVIKPILIG
KNSDMPLILVMLGILGGAFAFGFLGVFIGPTLLAVAYTVLHDWTIGAPAARALVPDVKAL
VVDDPGPVKKVP