Protein Info for BPHYT_RS06600 in Burkholderia phytofirmans PsJN

Annotation: polynucleotide phosphorylase/polyadenylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 716 TIGR03591: polyribonucleotide nucleotidyltransferase" amino acids 10 to 696 (687 residues), 1061.7 bits, see alignment E=0 PF01138: RNase_PH" amino acids 15 to 144 (130 residues), 101.5 bits, see alignment E=1.2e-32 amino acids 329 to 461 (133 residues), 108.3 bits, see alignment E=9.6e-35 PF03725: RNase_PH_C" amino acids 147 to 210 (64 residues), 45.8 bits, see alignment E=1.2e-15 amino acids 466 to 534 (69 residues), 25.6 bits, see alignment E=2.4e-09 PF03726: PNPase" amino acids 242 to 325 (84 residues), 62 bits, see alignment E=1.5e-20 PF00013: KH_1" amino acids 561 to 618 (58 residues), 46.5 bits, see alignment 6.1e-16 PF00575: S1" amino acids 624 to 695 (72 residues), 63.9 bits, see alignment E=3.7e-21

Best Hits

Swiss-Prot: 100% identical to PNP_PARPJ: Polyribonucleotide nucleotidyltransferase (pnp) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00962, polyribonucleotide nucleotidyltransferase [EC: 2.7.7.8] (inferred from 100% identity to bpy:Bphyt_1339)

Predicted SEED Role

"Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Polyadenylation bacterial (EC 2.7.7.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2E3 at UniProt or InterPro

Protein Sequence (716 amino acids)

>BPHYT_RS06600 polynucleotide phosphorylase/polyadenylase (Burkholderia phytofirmans PsJN)
MFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDVEDTVVLATVVGAKTAKPGQDFFPLT
VDYLEKTYAAGKIPGGFFRREGRPSEGETLISRLIDRPLRPLFPEGFYNEVQVVIHVLSL
NPEIPADIPALIGASAALAVSGLPFNGPVGAARVAYINNEYVLNPTRPQMKESALDLIVA
GTERAVLMVESEAQQLSEEVMLGGVVFGHEQMQIAIDAIHDLVREGGKPEWDWQPAAKNE
PLIARVTELAQADLLAAYQLRDKQARSAKLKEVYAATSKKLEEDAAAGGTVAADKATVGN
VLFDIEAKIVRTQILNGEPRIDGRDTRTVRPIEIRTGVLPRTHGSALFTRGETQAMVVAT
LGTKGDEQNIDALEGEYRERFMLHYNMPPFATGETGRVGSPKRREIGHGRLAKRALAACL
PSADEFGYSIRVVSEITESNGSSSMASVCGGCLALMDAGVPMKAHVAGIAMGLILEGNKF
AVLTDILGDEDHLGDMDFKVAGTEQGVTALQMDIKIQGITKEIMQVALAQAKEGRMHILS
KMTSAVSGANTVLSDYAPRMITIKINPEKIRDVIGKGGSVIRALTEETGTTIDISDDGVV
TIASTSSEGMAEAKKRIENITLEVEVGQVYEGTVLKLLDFGAIVNILPGKDGLLHISEIA
NERIKDINDYLKDGQQVKVKVIQTDEKGRVRLSAKALLNEGANGASGAPQGEPTPQ