Protein Info for BPHYT_RS06480 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 829 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 253 to 274 (22 residues), see Phobius details amino acids 306 to 331 (26 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details amino acids 416 to 438 (23 residues), see Phobius details amino acids 469 to 488 (20 residues), see Phobius details amino acids 704 to 725 (22 residues), see Phobius details amino acids 756 to 780 (25 residues), see Phobius details amino acids 793 to 814 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 14 to 171 (158 residues), 28.9 bits, see alignment E=1.4e-10 PF02687: FtsX" amino acids 257 to 375 (119 residues), 39.5 bits, see alignment E=5e-14 amino acids 708 to 820 (113 residues), 51.9 bits, see alignment E=7.2e-18

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to bpy:Bphyt_1315)

Predicted SEED Role

"ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2B9 at UniProt or InterPro

Protein Sequence (829 amino acids)

>BPHYT_RS06480 ABC transporter permease (Burkholderia phytofirmans PsJN)
MTSRDWRAGELTMLLLALVLAVAALSSVGFLADRLHQGLERDARRMIAADFIVRADHPVD
PQFAAQAKALGLKTASTAIFPSMINSTGTQPVSRLAAIKAVSPGYPLRGALRIAPAPGAA
DHPAQSIPPPGVVWVDQALLDALKVRVGDRVKVGGRDFMIGAVITRELDRGFSFVNFSPR
LMLRADDVPSTGLVTYGSRVTYRLLVAGTDESVARFAQFAHERVDGGKMRGVALESLQDG
QPQVRQTLDRASHFLTLVSLLTALLAAVAIAMAAHRYMRRHLDGCAAMRCLGASQSTLRA
LFTLEFVGLGLIGGALGVALGFLGHLALLTWLGSLIDVVLPYPTAWPALEGIAAGLVLLL
GFALPPLLPLTRVPPVRVLRREWGEAGRTAWAAYALGIALFAALLIIAAGELKLGGIVAG
GFAGGMLVFACIARLALWGAARVVRSERVNASIGWRYALASLERRSSASALQITALGIGL
MCLLLIAMTRNDLVAGWRKSTPPDAPNEFIIDIQPDQRDAVTQYLSTHGVPGTVLAPMVR
GRLTAINGKPVNPDSFKGDDAKRLVDREFNLSYTTELPDDNRLAAGTWYGDTTTPQISIE
QGLAKLINVKPGDMLRFDVTGLQIDAPVTSVRKLDWGSFKVNFFVLMPPAALQDFPATFI
TSFHLPQEKQSTIDGLIAAYPNLTAIDTGPILAQVQRVLQQVIGAVQFLFAFTLAAGVLV
LYAALAGTRDERMRESALLRALGASHRQVRAVQVAEFVAVGALAGLMAAAGAQAIGYVLA
TRVFEFYLSFNPWLLPAGIAAGIACAGVGGWLSLRHVLARPALQSLRDA