Protein Info for BPHYT_RS06320 in Burkholderia phytofirmans PsJN

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF00072: Response_reg" amino acids 6 to 128 (123 residues), 66.4 bits, see alignment E=1.3e-22

Best Hits

Swiss-Prot: 40% identical to RCP1_SYNY3: Response regulator rcp1 (rcp1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 99% identity to bpy:Bphyt_1283)

Predicted SEED Role

"response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T287 at UniProt or InterPro

Protein Sequence (145 amino acids)

>BPHYT_RS06320 chemotaxis protein CheY (Burkholderia phytofirmans PsJN)
MLRPFLLVEDNPNDVELTLIALEKTRLANPVVSLRDGEEALQYLRREGQWANRSEDNPAV
ILLDKKLPKIDGHEVLKALRADDKLKRIPVVMLTSSREESDLLRSYDLGVNAYVVKPVAF
DDFMAAINDLGVFWGVLNEPPPYPR