Protein Info for BPHYT_RS06215 in Burkholderia phytofirmans PsJN

Annotation: recombinase RdgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF04381: RdgC" amino acids 1 to 296 (296 residues), 380.7 bits, see alignment E=2.6e-118

Best Hits

Swiss-Prot: 80% identical to RDGC_BURCC: Recombination-associated protein RdgC (rdgC) from Burkholderia cenocepacia (strain MC0-3)

KEGG orthology group: K03554, recombination associated protein RdgC (inferred from 100% identity to bpy:Bphyt_1262)

Predicted SEED Role

"DNA recombination-dependent growth factor C" in subsystem CBSS-562.2.peg.5158 SK3 including or DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T266 at UniProt or InterPro

Protein Sequence (308 amino acids)

>BPHYT_RS06215 recombinase RdgC (Burkholderia phytofirmans PsJN)
MWFKNLQLHRLPAPWSVTAEQMQKWLAPHAFAPGNSVEMQSHGWASPRDNDSLVYALNGQ
MLLVFRAEKKLLPASVVTQVTKERALELEDQQGFKPSRKQMRELKEQVTDELLPRAFSIR
RDTRVWIDCKNGWLVIDAASQAVADEVRGLLVKSIDQLPLGTVRVTHSPVAAMTEWLLSG
EGPAGFTLDQDTELRSPTEGNATVRYVGHTLDAEDMRRHIEAGKQCMRLAMTWNDRVSFV
LTPSLTIKRIAPLDVLKEASDPTAQNDDERFDSDVTLMTAELDRMLSDLLDALGGEQGGE
AMPQAKAA