Protein Info for BPHYT_RS06195 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 13 to 48 (36 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details PF04932: Wzy_C" amino acids 184 to 350 (167 residues), 50.1 bits, see alignment E=1.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1258)

Predicted SEED Role

"FIG00455038: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T262 at UniProt or InterPro

Protein Sequence (448 amino acids)

>BPHYT_RS06195 membrane protein (Burkholderia phytofirmans PsJN)
MTHTAARVERVFWVACPVILFVVMFGHMTAIVFNALALMALGVAAAAWSPERPSLWRWPL
ALPIAGWAGWSLASVAWSMYPMISLHAWCDEVLYPLVSFWGFWLFGTQLRRPEPVVAVNW
IACLAVAVISALNWGHLQPPTANTFPMHFYNRVGHTSTLAVFAMALFAGFLLRPRWRVIG
ASGIVLCLFIGLATLNRFFWPAAAATLLVALFPLYRRRLPLALLVVAVVGAAGVGTLELS
SRLRSAALPPAAQQPHDLAIEGHQVYVPGSLSAIGDTVSADTRPKLWAFYIREAERHAWV
GVGFGKPLPGIVYRSEMPASLLAVEPQALTHAHNLFINTWLQTGFVGMVLQTVLLLCLAL
RFWRLRRVNPWLCAAGVALVAGMIAKNSTDDFMWQTTMLAFWAFAGLLLGCAEQARAPGA
ASSGTARGQSTAARSEQRREAPTAELGE