Protein Info for BPHYT_RS06185 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF13579: Glyco_trans_4_4" amino acids 15 to 163 (149 residues), 42.9 bits, see alignment E=1.7e-14 PF13439: Glyco_transf_4" amino acids 15 to 170 (156 residues), 87.4 bits, see alignment E=2.9e-28 PF00534: Glycos_transf_1" amino acids 181 to 317 (137 residues), 53.9 bits, see alignment E=4e-18 PF13692: Glyco_trans_1_4" amino acids 205 to 314 (110 residues), 44.1 bits, see alignment E=6.6e-15 PF20706: GT4-conflict" amino acids 243 to 294 (52 residues), 27.8 bits, see alignment 3.3e-10

Best Hits

Swiss-Prot: 68% identical to Y986_BURTA: Probable transglycosylase BTH_I0986 (BTH_I0986) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1256)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T260 at UniProt or InterPro

Protein Sequence (358 amino acids)

>BPHYT_RS06185 glycosyl transferase family 1 (Burkholderia phytofirmans PsJN)
MKKLGLSSNALRHSGGLERYAMDLVRGFAALGVEPAFFARRFDASLPEFKLVEPHRINVS
FLPGKLRDRWFSWRLRAARRAAQVDVLIGCNRVDSSEMAICGGTHLGFLRATGRERKRSD
DWQIALERRQYERSKVVVAHSQLMHDELRELYGVDEAKIRVLYPPVDATRFAPTDAATRA
ALRQKYGFADHEIVLLFPSSSHERKGLPLIEAALRDTSLPVVVAVAGRPPARTSERLRYI
GYVKELAECYQAADFTILASTYEPFGLVGIESVMCGTPVIFPSSIGCCDAIAPHAKFVFA
PHDLADLRATLERAVRAHGDGTRRAPSELARDAVLYNASVTAHASALLTLARQIDASR