Protein Info for BPHYT_RS05620 in Burkholderia phytofirmans PsJN

Annotation: CsbD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 63 PF05532: CsbD" amino acids 4 to 56 (53 residues), 65.1 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 54% identical to Y8179_RHILO: UPF0337 protein mll8179 (mll8179) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: None (inferred from 95% identity to bxe:Bxe_A3352)

Predicted SEED Role

"Uncharacterized protein conserved in bacteria"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1V0 at UniProt or InterPro

Protein Sequence (63 amino acids)

>BPHYT_RS05620 CsbD family protein (Burkholderia phytofirmans PsJN)
MNKDQVKGVAEQVKGKVNEAVGKATDNPGKEIKGDLQQGAGKVQKAYGDAKEDAKDNAKR
NAP