Protein Info for BPHYT_RS05505 in Burkholderia phytofirmans PsJN

Annotation: histidine/lysine/arginine/ornithine ABC transporter permease HisQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 191 to 216 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 8 to 115 (108 residues), 63 bits, see alignment E=1.6e-21 PF00528: BPD_transp_1" amino acids 30 to 221 (192 residues), 89.4 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 62% identical to HISQ_ECOLI: Histidine transport system permease protein HisQ (hisQ) from Escherichia coli (strain K12)

KEGG orthology group: K10016, histidine transport system permease protein (inferred from 100% identity to bpy:Bphyt_1122)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1I1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>BPHYT_RS05505 histidine/lysine/arginine/ornithine ABC transporter permease HisQ (Burkholderia phytofirmans PsJN)
MFLQGYGPLLLNGTWQTVKLAVLSLAFAFVLGLLGAAAKLSKNRFSYGVGTVYTTLVRGV
PDLVLMLLLFYSIQIWLNNLTDLLGWDQIDIDPFVAGVAVLGFIYGAYFTETFRGAFLAV
PRGQLEAGAAYGMTGWQVFTRVMFPQMMRFALPGIGNNWQVMVKATALVSIIGLADVVKA
SQDAGKGTLRFFFFTLFAGAIYLVITTVSNFVLMYLEKRYSTGVRKADL