Protein Info for BPHYT_RS05155 in Burkholderia phytofirmans PsJN

Annotation: acetyltransferase GCN5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF13673: Acetyltransf_10" amino acids 60 to 151 (92 residues), 30.3 bits, see alignment E=7.5e-11 PF00583: Acetyltransf_1" amino acids 62 to 144 (83 residues), 59 bits, see alignment E=1.1e-19 PF13508: Acetyltransf_7" amino acids 62 to 144 (83 residues), 33.5 bits, see alignment E=8.9e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1053)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1B5 at UniProt or InterPro

Protein Sequence (177 amino acids)

>BPHYT_RS05155 acetyltransferase GCN5 (Burkholderia phytofirmans PsJN)
MSPSLTVRRIAADQGAVFRELRTASLREAPYAFGATLEDALSADAASFDATAADHAVSFT
FTTFILYTEGHPAGLIEAYFDDSAARRAFVCELWVAPAVRHLRGGELLVDSAAAWLANEG
ATEIYAWVADANRNAMRFYEALGFGPTGEHRRVTRAPDQAESLLVRHVPTTSQVFQQ