Protein Info for BPHYT_RS05140 in Burkholderia phytofirmans PsJN

Annotation: manganese transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 258 to 283 (26 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details amino acids 409 to 431 (23 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 34 to 398 (365 residues), 314.2 bits, see alignment E=8e-98 PF01566: Nramp" amino acids 56 to 404 (349 residues), 409.8 bits, see alignment E=4.9e-127

Best Hits

Swiss-Prot: 67% identical to MNTH_VEREI: Divalent metal cation transporter MntH (mntH) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K03322, manganese transport protein (inferred from 100% identity to bpy:Bphyt_1050)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1B2 at UniProt or InterPro

Protein Sequence (441 amino acids)

>BPHYT_RS05140 manganese transporter (Burkholderia phytofirmans PsJN)
MNEAISQGTVPQTLTEQTCFDIRETLAGRRRGVRAMLPFVGPAVVASIAYMDPGNFATNI
QAGAGYGYTLLWVVAVANVVAMLFQSLSAKLGLVTGRNLAELCREALPRRSVLAMWGISE
IAAMATDLAEFVGGAIGVSLLTHLPMIPSMLITAAVTYGLLQFEKRGFRPLELAIAALIG
VIGLSYLAELLIAPVHWPSVVAHTFTPRVPDSNALTISVGIIGATVMPHVLFLHSGLTQN
RVKPRNDGERARLLRFSNIEVVVALGVAGFINMAMVIMASSAFHAGHPEIASIETAWRTL
TPLLGGAAAGLFLAALIASGVSSSVVGTMAGQMIMQGFVGFHIPVWARRLITMAPAFAVV
ACGVDATRALVLSQVVLSIALPVPMIALVWFTSRGDLMGRYRNRRATTFAAILGTVVVLA
LNLILLLQAAGISPWPPFHAA