Protein Info for BPHYT_RS05055 in Burkholderia phytofirmans PsJN

Annotation: flagellar hook protein FliD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF02465: FliD_N" amino acids 34 to 130 (97 residues), 62 bits, see alignment E=1e-20 PF07196: Flagellin_IN" amino acids 147 to 203 (57 residues), 35.9 bits, see alignment 1.1e-12 PF07195: FliD_C" amino acids 256 to 480 (225 residues), 175.4 bits, see alignment E=2e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1034)

Predicted SEED Role

"Flagellar hook-associated protein FliD" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T196 at UniProt or InterPro

Protein Sequence (502 amino acids)

>BPHYT_RS05055 flagellar hook protein FliD (Burkholderia phytofirmans PsJN)
MSSITSSVNSATANAQSQVQQAAQSIISGSTGNSSMDVASLVSVLVNAKTAGQAASLQAR
QTSDNTTLSAYGALTSALSALQAAIKNLSDGTTLSTFAATASGKGLDPKAGPGAVAGSYA
IDVTQIASSQSLASAAFGATTKLGTGTLTISVGGKPMDVSIDSTNNTLSGIASAINKASN
NPGVTATIVTGTGGAHLVLRSATTGSGNTINVATSNVQNDAGLSSLGVTSTPGANGGAST
IVSSDAGNAWRQSEVAQDALVTIGGIAARSANNAVTDAIDGVTLNLSAASVGSPQTLTIA
PDTTAQNTAITNFANLYNTVVTTIGKLSSYDKSSKTGGALLGDSTLLTVKNALASIIAGG
VGKGTSVVSLGHIGITLKGDPADGTLVVDNAKLTTALNSSPAQVSALFNSTDGVGAKLNK
SIDEFTRTGGIIDTRNNALNADLKSVTAQQTKLSDYATQLTKQYQSQFTALNTLMATMNN
NSAYLTALFGGSKSAGALATNK