Protein Info for BPHYT_RS05025 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13416: SBP_bac_8" amino acids 65 to 345 (281 residues), 73.5 bits, see alignment E=2.6e-24 PF01547: SBP_bac_1" amino acids 66 to 315 (250 residues), 91.5 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 51% identical to SP39_BRUSU: Probable sugar-binding periplasmic protein (BRA0693) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_1028)

Predicted SEED Role

"ABC-type sugar transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T194 at UniProt or InterPro

Protein Sequence (415 amino acids)

>BPHYT_RS05025 sugar ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MKFRAIMGALCAAGLMCGVSAVQAAESIEVLHWWTSGGESKAVGVLKDDMTKQGYTWKDF
AVAGGAGAAAMTALKTQVISGNAPSAAQIKGPLIQDWASQGVLVPIDAAAGDWKKNLPPE
IDKIMHADGHYVAAPFSVHRVNWLYINKAALDKAGGKAPTTWPEFFAVADKMKAAGIQPI
AMGGQPWQDLTLWEDVVLSQGADFYKKALVDLDEKTLTSDKMVGVFDTVRKIQGYFDAGR
TGRDWNLATAMVINGKAGMQFMGDWAKGEFANAGKKSGSDYICAAVPGTEKSYTFNVDSF
VFFQQKGQKAATPGQLALAKTIMSPEFQEQFSLNKGSIPVRLGVSMAKFDDCAKKSYADE
QVAIKSGGYVPSLAHGMAQPDAAAGAISDVVTKFMNSQQDSKSAVAALAKAAKTK