Protein Info for BPHYT_RS04855 in Burkholderia phytofirmans PsJN

Annotation: iron ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 54 (54 residues), see Phobius details transmembrane" amino acids 81 to 102 (22 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 260 to 287 (28 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details PF01032: FecCD" amino acids 31 to 346 (316 residues), 252.7 bits, see alignment E=2.3e-79

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to bpy:Bphyt_0996)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T158 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BPHYT_RS04855 iron ABC transporter (Burkholderia phytofirmans PsJN)
MNRHSSSMPATLRGMSAKRAAAIWLALAGIALAVLMASLALGSVTLAPMRVLAALMPSHA
PASGSSDLAAEIVRTLRLPRAVAGFACGALLALAGALLQVLLRNPLAEPYVLGVSGGAAS
FALIAMIAGCAWWIVDASAFAGAFVSILLVLGLARRELWRGEPQDTSPRLLLTGAVIAAG
WGALITLLLNLAPDNRLRGMLFWLTGDLNGGAMPWTALAALVIVLVAIVPAAPRLNVLLR
GDAAAQALGVAVMPLRLRVYLVASLAAAAAVTTAGTIGFVGLVVPHMLRLAFGNDQRMLL
PAAALGGGVAVMGADLIARTVIAPAQLPVGVITSIIGVPVFLWMLLHRRR