Protein Info for BPHYT_RS04850 in Burkholderia phytofirmans PsJN

Annotation: TonB-denpendent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07715: Plug" amino acids 65 to 166 (102 residues), 80.6 bits, see alignment E=1.2e-26 PF00593: TonB_dep_Rec" amino acids 191 to 602 (412 residues), 129.1 bits, see alignment E=4.6e-41

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to bpy:Bphyt_0995)

Predicted SEED Role

"Outer membrane vitamin B12 receptor BtuB" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T157 at UniProt or InterPro

Protein Sequence (629 amino acids)

>BPHYT_RS04850 TonB-denpendent receptor (Burkholderia phytofirmans PsJN)
MLSPIARAALLAFASLPIVVHAQAASSSASSSAQDSSAAEPSAAVLSPVVVTADRAPQAL
VDTIPQTSLFDQQDIADTTATDLPGLLQLAPGAQISRTGGPGSTASLSLRGASSTQSLLL
IDGVRVDSVSLGAPQLAQIPLDQIDHVEVVNGNVSALYGSGAIGGVVQVFTKDGGDHPPR
FNFSLGYGSYHTQTQQAGVNGALDKDGKTTFSISLARSKDDGFSSLNTKEAPNANPNANG
YLNESISASLRHKFNDRWDAGVSYFQSNGNNSYDNAYGVPTDLNNLYSKVRQVSAFANGK
LADWWTTHFIVAEGDDRSVSNTNGVYNGRFDTDNRQYTWQNDFALAAQQKLQVGYEHLDQ
SLDSDTFAAPDRHVDSGFAGYTGRFGRNQIQANVRRDQYSDFGGANSYYLGYGFDITGHW
KVSASYSDSFRAPSFDDLYYPFSGNPSIQPERSHSIEAALQYASNALGVMRLTAFQTRYS
NLINYEQVTPGIYLAENVGHAKVQGLEGSWSGHVGKTDVRASVTLQNPVDLDNDADLVRR
ARRFGALTVNRSIAGWRVGGEWIVSGPSNDSSGKLGGYGVVNLSARYNITKAWYVAAQIQ
NLLDKDYETAYSYNSPRRGAYLTVGWQQQ