Protein Info for BPHYT_RS04765 in Burkholderia phytofirmans PsJN

Updated annotation (from data): 2-deoxy-D-ribonate transporter
Rationale: Important for the utilization of deoxyribonate. Similar to the putative deoxyribonate transporter in several other bacteria.
Original annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 391 (363 residues), 160.2 bits, see alignment E=3.3e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0978)

Predicted SEED Role

"D-galactonate transporter" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T140 at UniProt or InterPro

Protein Sequence (447 amino acids)

>BPHYT_RS04765 2-deoxy-D-ribonate transporter (Burkholderia phytofirmans PsJN)
MTTQSAGPAGNALHRIATHKAMLRLIPLMCVIYFMSYLDRTNVSLAKARLATDLGISAAA
YGLGAGIFFIGYALLEVPSNLVAHRVGPRRWIARIAITWGALSASMMFVQGEWSFYAIRV
LLGIAEAGLFPALMYMVTMWFAPQDRSVAVGWIYTAPALALVIGNPLGGAFMQMDGLGGL
HGWQWLFLLEGLPTIFVGVLLWFKLPEKPSDARWLSADEARALEARAVPDAAHPGMFSQD
WVAALKRPATVLIGLIYFLNQVAFVGLVFFTPAMIQQMHVKSPLMIGVLSSSVGIGFLLG
VLVLPRIHRRVTNDCLYLGVLTLGLVTSAILFMSTSVLSTQLLLFVATAFFAGGVLPLYW
AIAMKRLHGIQAAAGLAFINTIGLIGGFVGPYLFGLAESASGHSASGFSVVVGASVLGLV
LVPLLAKAIQSEGRAASLAEPLLNTES