Protein Info for BPHYT_RS04530 in Burkholderia phytofirmans PsJN

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 24 (16 residues), see Phobius details amino acids 45 to 69 (25 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 12 to 318 (307 residues), 93.3 bits, see alignment E=7.7e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0932)

Predicted SEED Role

"FIG00459899: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0P9 at UniProt or InterPro

Protein Sequence (361 amino acids)

>BPHYT_RS04530 acyltransferase (Burkholderia phytofirmans PsJN)
MVKEERIRGGLAISISAIVCAEVLQRISDAGFLQDGHMARLLKVLLYAAGTLGYPTAFFL
LGVSTLAYLQRSRARLLKSLASTVLYPYLLWSILQMAVQWLVADYRDYPARQFELARLAW
APIGQFWFLYALFICQIVAFITVWPRPTTVRCALTVANRSLIVAMILASATVAIRSHWGI
VTMTCWGLVFFLAGVLLASWPDRHESHASGVYVALAGAIAFGAAAFMGQRFGHHLDLYSL
LTSFLGVAAALSVGRCLPIWRRSRWIVLIGLTWKPIYLMHVLATAVVWNALLAFGIGQPV
VHFVLGSAVGLTLPIAIYVLAKRLRIASWAGFAETAAARSESVGSADKPAPRADKSAKSR
V