Protein Info for BPHYT_RS04410 in Burkholderia phytofirmans PsJN

Annotation: heptose 1-phosphate adenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR02198: bifunctional protein RfaE, domain I" amino acids 14 to 319 (306 residues), 401.2 bits, see alignment E=1.5e-124 PF00294: PfkB" amino acids 18 to 308 (291 residues), 150.5 bits, see alignment E=7.2e-48 PF08543: Phos_pyr_kin" amino acids 194 to 291 (98 residues), 28.3 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K03272, D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC: 2.7.1.- 2.7.7.-] (inferred from 100% identity to bpy:Bphyt_0908)

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-, 2.7.1.-, 2.7.7.-

Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0M5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BPHYT_RS04410 heptose 1-phosphate adenyltransferase (Burkholderia phytofirmans PsJN)
MTRNPPVKLSPPDFDCAQLMVVGDVMLDWYWHGSTSRISPEAPVPVVHVQAEETRVGGAG
NVALNAAALGARVRLLGLAGQDAHADRIEELLREGGVDCVLQRVAGSKTITKLRILSRHQ
QMIRADFEDHFPERNGDELIFSFERQLHEVDAVVLSDYAKGSLHDSKNLISAARRTGKPV
IVDPKGTDFERYRGATVITPNLSEFEAVVGRCDSDATIEQKGAALCDAFEFEAALVTRSE
KGMTLIARGHAPLHLPTRAREVFDVTGAGDTVVATLSAALGAGMPLDEAVVLSNVAAGIV
VAKLGTATVRRPELQQALQ