Protein Info for BPHYT_RS04385 in Burkholderia phytofirmans PsJN

Annotation: nucleoside-diphosphate sugar oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details PF13727: CoA_binding_3" amino acids 62 to 219 (158 residues), 37.6 bits, see alignment E=1.2e-12 PF02629: CoA_binding" amino acids 146 to 238 (93 residues), 24.4 bits, see alignment E=2.1e-08 PF01408: GFO_IDH_MocA" amino acids 147 to 235 (89 residues), 25.3 bits, see alignment E=1.1e-08 PF01370: Epimerase" amino acids 285 to 475 (191 residues), 63.3 bits, see alignment E=1.2e-20 PF04321: RmlD_sub_bind" amino acids 285 to 461 (177 residues), 39.8 bits, see alignment E=1.5e-13 PF02719: Polysacc_synt_2" amino acids 285 to 568 (284 residues), 402.1 bits, see alignment E=6.8e-124 PF16363: GDP_Man_Dehyd" amino acids 286 to 410 (125 residues), 35.4 bits, see alignment E=4.5e-12 PF01073: 3Beta_HSD" amino acids 286 to 415 (130 residues), 38.6 bits, see alignment E=3.4e-13 PF07993: NAD_binding_4" amino acids 287 to 427 (141 residues), 22.5 bits, see alignment E=2.8e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0902)

Predicted SEED Role

"Nucleoside-diphosphate sugar epimerase/dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0L7 at UniProt or InterPro

Protein Sequence (625 amino acids)

>BPHYT_RS04385 nucleoside-diphosphate sugar oxidoreductase (Burkholderia phytofirmans PsJN)
MFRHKASWLSFSAFAFDLCAVAGAWLAAYLIRFNGYVPDEFWSGAVRTLIWVLPVYGVMF
RIFGLYRGMWVFASLPDLMRIAKAVMAGAFTMMMVAVMAQPHPIIPRSVLAVSPLLLFLA
MGGSRALYRASKEFYLYGGLVGQGKPVVVLGAGNAGASLARELSRSSEWRLVGLLDDDPA
KQGREIYGYKVWGPISDLQHWASDMKVEHAIIAIPSASVDAQRRVATLCVRAGVRAMVLP
ALTTLTQGEAFLSRVRQIDLEDLLGREPVRIDMPHVEALLSGRVVMVTGAGGSIGSELCR
QILRFEPAQLIAFDLSEYAMYRLTEELHDRFPKLSVVPVIGDAKDSLLLDQVLSRYTPHI
LFHAAAYKHVPLMEELNAWQAVRNNVLGTYRVARAAIRHDVKHFVLISTDKAVNPTNVMG
ASKRLAEMACQALQQTSTRTQFETVRFGNVLGSAGSVIPKFQQQIAKGGPVTVTHPEITR
FFMTIPEASQLVLQASSMGHGGEIFILDMGEPVKIVDLARDLIRLYGFSEEHIRIVFTGL
RPGEKLYEELLADDEATTRTPHPKLRIAQAREAPDNLLDELLPWLMQHRVPSDQEVRRDL
RRWVPEYQPAATPALHSVASATRAS