Protein Info for BPHYT_RS04140 in Burkholderia phytofirmans PsJN

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 25 to 27 (3 residues), see Phobius details amino acids 42 to 69 (28 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details PF01943: Polysacc_synt" amino acids 5 to 272 (268 residues), 165.4 bits, see alignment E=2.8e-52 PF13440: Polysacc_synt_3" amino acids 30 to 325 (296 residues), 47.4 bits, see alignment E=2.5e-16 PF14667: Polysacc_synt_C" amino acids 327 to 407 (81 residues), 35.1 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 100% identity to bpy:Bphyt_0849)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0G6 at UniProt or InterPro

Protein Sequence (419 amino acids)

>BPHYT_RS04140 polysaccharide biosynthesis protein (Burkholderia phytofirmans PsJN)
MAHRLLQNMLALSVLQLANMVLPLATLPYLFRILGPDQFGAYVFAQGVIAYLVLLADYGF
ILSATGAIAKVQNDRNAVSKIFWTTQAAKCIVACVGLVLLLLGVLFVPKLSELRLVMFAT
FPLVIGTLLFPQWLFQGLERMSFVTISTLTSRLLVIPATYLFIHSSDDTWRAALISSMST
VVAGCISLLFAARLRLISFCLPSVSEVAGAFREGWHVFMATAAISMYTTTNSVILGSLAG
NVTLGYFGAADKIRNVAQAVITPLGNALYPRVNALFAEDTQKAFALVRKALYAMNAIMLF
VSVMLWVLAPWIVRFGMGPQYEPAIAVLRWLAFVPWLVALSNVLGLQMMLPLGMKRKFSE
ILLVSGVFNVALLVPLSSAFGAQGAAMSILATEALVTATMAFYLIQKRVPLFAPRAVTD