Protein Info for BPHYT_RS03965 in Burkholderia phytofirmans PsJN

Annotation: GDP-mannose mannosyl hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 16 to 144 (129 residues), 67.2 bits, E=7.6e-23

Best Hits

Swiss-Prot: 51% identical to GMM_SHIFL: GDP-mannose mannosyl hydrolase (gmm) from Shigella flexneri

KEGG orthology group: K03207, colanic acid biosynthesis protein WcaH [EC: 3.6.1.-] (inferred from 99% identity to bpy:Bphyt_0813)

MetaCyc: 50% identical to GDP-mannose mannosyl hydrolase (Escherichia coli K-12 substr. MG1655)
GDP-glucosidase. [EC: 3.2.1.42]; 3.2.1.42 [EC: 3.2.1.42]

Predicted SEED Role

"GDP-mannose mannosyl hydrolase (EC 3.6.1.-)" in subsystem Colanic acid biosynthesis or Mannose Metabolism or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.2.1.42 or 3.6.1.-

Sequence Analysis Tools

See B2T0D0 at UniProt or InterPro

Protein Sequence (150 amino acids)

>BPHYT_RS03965 GDP-mannose mannosyl hydrolase (Burkholderia phytofirmans PsJN)
MLTEIDFLDVVRLTPLVAFDLIVSDTQGRVLVGRRRNRPARGTWFVPGGRIHKDETLDAA
FARIADAELGIAKLARSTASFEGVFEHHYSDNFAGEPDVSTHYIVLAYSLTLTGTAPLGR
PEQHSEYVWLAPSDLLAREDVHDNTKAYFR