Protein Info for BPHYT_RS03860 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 219 to 246 (28 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 300 (279 residues), 62.7 bits, see alignment E=1.5e-21 amino acids 225 to 398 (174 residues), 39 bits, see alignment E=2.5e-14

Best Hits

Swiss-Prot: 81% identical to Y4407_BURM7: Uncharacterized MFS-type transporter BMA10247_1907 (BMA10247_1907) from Burkholderia mallei (strain NCTC 10247)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0792)

Predicted SEED Role

"Xanthine transporter,putative" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0B0 at UniProt or InterPro

Protein Sequence (403 amino acids)

>BPHYT_RS03860 MFS transporter (Burkholderia phytofirmans PsJN)
MSTDSATPRTEFATTMQIIPVVFFTFLCYLTIGIPLAVLPGYVHDDLGYSAVLAGAAISV
QYLATLASRPLAGRSADTLGPKRTVTIGLLGCGASGVLLLLAVLCGRWPVVSLGLLVCSR
LVLGFGESLCGTGAILWGIGRVGTSNNARVISWNGIATYGALAVGAPLGVAIAHTVGFAA
LGILVIMLAALGFYLARPIAPVPIVHGERMSYRSVFTRVLPHGLGLALGSAGFGSIATFI
TLFYAAKHWPNAALSLTVFGTLFIGARLLFANTIKTYGGFRVAIASFSFECAGLLMLWLA
PEPHIALAGAALTGFGFALVFPALGVEAVGLVPPASRGAALSAYSVFLDLSLGITGPLAG
YIAGEFGYAQVFLFAAVASAAAVGLSTMLYLRNARAPGSPAIT