Protein Info for BPHYT_RS03850 in Burkholderia phytofirmans PsJN

Annotation: aspartate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 TIGR03801: aspartate 4-decarboxylase" amino acids 21 to 539 (519 residues), 794.1 bits, see alignment E=2.5e-243 PF00155: Aminotran_1_2" amino acids 187 to 524 (338 residues), 87.6 bits, see alignment E=5e-29

Best Hits

Swiss-Prot: 60% identical to ASDP_PSESP: Bifunctional aspartate aminotransferase and L-aspartate beta-decarboxylase (asD) from Pseudomonas sp.

KEGG orthology group: K09758, aspartate 4-decarboxylase [EC: 4.1.1.12] (inferred from 100% identity to bpy:Bphyt_0790)

Predicted SEED Role

"LSU ribosomal protein L4p (L1e)" in subsystem Ribosome LSU bacterial

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0A8 at UniProt or InterPro

Protein Sequence (554 amino acids)

>BPHYT_RS03850 aspartate aminotransferase (Burkholderia phytofirmans PsJN)
MAKEKGDKKHADMAQAGMAALSPFELKDELIKAAGGAAVERPANASMLNAGRGNPNFLAT
IPRHGFWQLGLFAMRESERSFAYMPEGVGGFPRREGLEERFDLFLRENKGVAGIDFLRGA
VSYVRDQLGYSAGDFLYEMCEGILASNYPVPDRMLKLSELIVGQYLRKEMIGDHPFVGEF
DVFAVEGGTAAMTYIFNTMRENHLIKAGDTIALGMPIFTPYIEIPRLNDYRLNVVNLEAD
VANGWQYSKKELDKLRDPKVKAFFLVNPSNPPSVKMDDESLRYIADIVKERPDLILLTDD
VYGTFADDFVSLFALAPKNTILVYSYSKYFGATGWRLGTIATHRDNVLDKLIADLPKDAK
KQLHERYESITTEPDKLKFIDRLVADSRTVALNHTAGLSTPQQVQMVLFSLFSLMDTPDA
YKNALKRLIRKRKQALYEEVGISFKDDDPNQVDYYTILDVEFLGERMFGREFVDWLLKNT
EPSELLFRLAREARVVLLPGLGFGTQHPSGRVSLANLNESDYRQIGRAMRKLIEELVERF
NAATGKNLDKTKVK