Protein Info for BPHYT_RS03845 in Burkholderia phytofirmans PsJN

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 385 to 404 (20 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details amino acids 449 to 468 (20 residues), see Phobius details amino acids 474 to 495 (22 residues), see Phobius details amino acids 536 to 559 (24 residues), see Phobius details TIGR03802: aspartate-alanine antiporter" amino acids 2 to 560 (559 residues), 743.2 bits, see alignment E=2e-227 PF06826: Asp-Al_Ex" amino acids 15 to 179 (165 residues), 116.5 bits, see alignment E=1.1e-37 amino acids 389 to 556 (168 residues), 114.3 bits, see alignment E=5.3e-37 PF02080: TrkA_C" amino acids 229 to 279 (51 residues), 27.6 bits, see alignment 2.2e-10 amino acids 326 to 370 (45 residues), 28 bits, see alignment 1.6e-10 TIGR01625: AspT/YidE/YbjL antiporter duplication domain" amino acids 392 to 544 (153 residues), 80.6 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0789)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0A7 at UniProt or InterPro

Protein Sequence (560 amino acids)

>BPHYT_RS03845 transporter (Burkholderia phytofirmans PsJN)
MDWLHHIFQKSPEIALFLSLAVGYFIGQINFGKFQLGGVGGSLLAAVVISQAGVTIDNGV
KSVMFAVFIYAVGYDSGPGFFNSLNRKTLREIAMALFLAVSALVTVVICAKLFHLNKGLA
AGLAGGALTQSAIIGTAGDAIARLGLPADQVKSLQSDVAIAYAVTYVFGSLGAIIVCVNI
LPKFMGQSLRDAAIQAERELTSGAPSVAPGQLSALPEMVGRAYKIDVSAGKTVKAVETQH
QDLLTIERIKRDGQQLDPAPDLVLKPDDVVLVVGRREAVVAFGASGGEVATVEDVGVVMQ
TRQGVFTRKGMNHTTIAAAREVVDRDMRHGVYIQGISRAGQPLPILPETELEHGDVITFY
GSPKDTKRAVEAAGYELPYSIKTDFIYMGVGLVLGLLIGLIVINVGGIPLTLGSGGGCLL
AGLLFGWMRGKHPMYGVMPSAASRLLQDFGLAAFVVVVGLNSGLQAVVTVKQLGITIFLL
GVFVTLFPLLLTMLFGRYVLKYNNAAILAGALSGSRSANPAFGGVLDKAESAVPTVPFAI
TYAIANVALTLLGPLVVGLV