Protein Info for BPHYT_RS03795 in Burkholderia phytofirmans PsJN

Annotation: 4-hydroxybenzoate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details amino acids 388 to 412 (25 residues), see Phobius details amino acids 419 to 441 (23 residues), see Phobius details PF07690: MFS_1" amino acids 37 to 295 (259 residues), 119 bits, see alignment E=3.5e-38 amino acids 267 to 443 (177 residues), 72.4 bits, see alignment E=5.2e-24 PF06779: MFS_4" amino acids 53 to 206 (154 residues), 29 bits, see alignment E=1.1e-10 PF00083: Sugar_tr" amino acids 63 to 407 (345 residues), 106 bits, see alignment E=3.6e-34

Best Hits

KEGG orthology group: K08195, MFS transporter, AAHS family, 4-hydroxybenzoate transporter (inferred from 100% identity to bpy:Bphyt_0779)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T097 at UniProt or InterPro

Protein Sequence (454 amino acids)

>BPHYT_RS03795 4-hydroxybenzoate transporter (Burkholderia phytofirmans PsJN)
MSAKPAAAAANVIEVEQVLGETHHPAFQLLLLVLCGLCLVIDGFDAQAMGYVAPSVIGEW
HVSKAALGPVFSASLFGMLLGALGLSVLADRIGRRPVLIGSTFFFALSMLATPFVTTIPA
LIALRFITGLGLGCIMPNAMALVGEFSTPAHRVKRMMLVSCGFTLGAALGGFISAALIPA
YGWRAVFWVGGAVPLLLALAMLVALPESLQFLVLKGRSERALRWLAKFNPALPIDANTRL
VVREKGNGGAPVAELFRAGRGPVTLILWAISFMNLIDLYFLSNWLPTVMRDAGYSPSTAV
IVGTVLQTGGVVGTLLLGWFIERFGFVRVLFVCFAGAALAVGTIGTVAHALPWLLLVVFA
GGFCVVGGQPAVNALAGHFYPTTLRSTGIGWSLGIGRIGSVIGPLIGGQLIALNWSNAAL
FHAAALPVLCSALLVIALAAATRQRGQSPEPRTA