Protein Info for BPHYT_RS03730 in Burkholderia phytofirmans PsJN

Annotation: transcriptional repressor NrdR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR00244: transcriptional regulator NrdR" amino acids 1 to 146 (146 residues), 192.5 bits, see alignment E=2e-61 PF03477: ATP-cone" amino acids 50 to 136 (87 residues), 71.4 bits, see alignment E=3.8e-24

Best Hits

Swiss-Prot: 100% identical to NRDR_PARPJ: Transcriptional repressor NrdR (nrdR) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 98% identity to bge:BC1002_0531)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T084 at UniProt or InterPro

Protein Sequence (160 amino acids)

>BPHYT_RS03730 transcriptional repressor NrdR (Burkholderia phytofirmans PsJN)
MHCPFCRHADTQVVDSRVSEDGATIRRRRRCPACDKRFTTYERVELALPSVVKKDGSRTE
FDRRKIVASMQLALRKRPVAADAIDAAVARIEYLLLGSGEREVRSERLGELVMNELRALD
TIAYVRFASVYRRFEDVSEFEDVIEEFRRASSPPKPSRKR