Protein Info for BPHYT_RS03470 in Burkholderia phytofirmans PsJN

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 70.1 bits, see alignment E=1.2e-23 PF03466: LysR_substrate" amino acids 88 to 301 (214 residues), 154.2 bits, see alignment E=3.2e-49

Best Hits

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 100% identity to bpy:Bphyt_0711)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX96 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BPHYT_RS03470 LysR family transcriptional regulator (Burkholderia phytofirmans PsJN)
MTLTELKYIVAVARERHFGRAAEACFVSQPTLSVAIKKLEDELNVQIFERGTSEVSVTPI
GEQIVTQAQRVLEQTLAIKEIAKQGKDPLVGPLRLGVIYTIGPYLLPTLVKQMIKRVPQM
PLMLQENYTLKLIELLKQGEIDVAIMALPFPETGLMLRPLYDEPFVVALPSGHAWENRPK
IDADDLKQETMLLLGSGHCFRDHVLGVCPELMRFSQNADGIQKTFEGSSLETIRHMVASG
VGITVLPRMSVHEVKPHAGGIDSGLLSYVAFDEPVPDRRVVLAWRKSFTRMPAIEAICDA
ISSCDLAGVKKLDLPVAVN